The record · 7 September 2026

Silent

Does ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click block AI crawlers?

We cannot say. ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click never answered us on 7 September 2026, so there was nothing to read.

Read straight out of the CrawlState record, a dated sweep of 1,163,843 domains on 7 September 2026. Nothing on this page is estimated, and nothing about ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click is inferred from what similar sites do.

What we wrote down

Verdictsilent

One of five: block, charge, signal, open, silent. The record keeps the strongest thing a site said, not every thing it said.

Reasonno answer

The note the sweep wrote at the moment it decided, in its own words.

HTTP statusno answer

Nothing came back from ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click inside the time we allow.

Swept7 September 2026

A record has a date on it or it is worthless. This one has this date.

What that actually means

This one is a gap, not a finding. We asked the site for its rules and got nothing back inside the time we allow — the domain may not resolve, the site may have been down, or something in front of it may have refused us. A site that does not answer is invisible to an AI crawler in the same way it was invisible to us, which is its own kind of problem, but it is not a policy.

How ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click compares

264,318 of the 1,163,843 domains we swept never answered, 22.7% of the whole record. It is a bigger group than most people expect.

Name an AI crawler and refuse it154,143 · 17.1%
Publish a licence or return a price4,790 · 0.53%
Carry a Content-Signal preference only2,463 · 0.3%
Declare nothing at all601,650 · 66.9%

Shares are of the 899,525 domains that answered. A further 264,318 never answered at all, which is why they are not in the bars above.

Find out what happens now

The record says what ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click declared on 7 September 2026. It does not say whether anyone obeyed it. The live report asks the site for its own homepage under three named AI crawlers and tells you what each one was actually served, which is usually the surprise.

If this is your site and the answer above is not the one you wanted, we will set the policy properly for you — robots.txt, Cloudflare and licence terms, done and checked. See what that costs.

Method: homepage, robots.txt and sitemap, on 7 September 2026. We record what came back and nothing else. How a verdict is decided · The awkward questions · The same record over an API